Arkivism
Panorama of the battlefield, Vicksburg, Miss
Public domain

Panorama of the battlefield, Vicksburg, Miss

Detroit Publishing Co · 1900 · photo, print, drawing

From the collection of Library of Congress. Free to download, adapt and use — no permission needed.

Subjects
panoramic photographsunited statesbattlefieldssiegemississippivicksburgvicksburg (miss.)history
Credit linePanorama of the battlefield, Vicksburg, Miss. 1900. Detroit Publishing Co. Detroit Publishing Company Collection, Library of Congress. Public domain.
Open in Explore View at source

Similar works

Panorama of the battlefield, Vicksburg, Miss.Panorama of the battlefield, Vicksburg, Miss. Untitled photo, possibly related to: Territory around Gallipolis, OhioUntitled photo, possibly related to: Territory around Gallipolis, Ohio Sheep and goat ranch in Kimble County, TexasSheep and goat ranch in Kimble County, Texas UntitledUntitled Pittsburgh, Pennsylvania (vicinity). Montour no. 4 mine of the Pittsburgh Coal Company. The mine seen from the hills to the westPittsburgh, Pennsylvania (vicinity). Montour no. 4 mine of the Pittsburgh Coal Company. The mine seen from the hills to the west Hightstown, New Jersey. Progress photograph taken during construction of the Jersey homesteads, a U.S. Resettlement Administration projectHightstown, New Jersey. Progress photograph taken during construction of the Jersey homesteads, a U.S. Resettlement Administration project