Arkivism
The Old kitchen fireplace, Mt. Vernon, Va.
Public domain

The Old kitchen fireplace, Mt. Vernon, Va.

Detroit Publishing Co. · 1900-01-01 · photo, print, drawing

From the collection of Library of Congress. Free to download, adapt and use — no permission needed.

Subjects
mount vernon (estate)dwellingskitchensfireplacesvirginiawashington, georgeestatesunited states
Credit lineThe Old kitchen fireplace, Mt. Vernon, Va.. 1900-01-01. Detroit Publishing Co.. Detroit Publishing Company Collection, Library of Congress. Public domain.
Open in Explore View at source

Similar works

The Fireplace in living room, Paul Revere House, Boston, Mass.The Fireplace in living room, Paul Revere House, Boston, Mass. Martha Washington kitchen at Mt. VernonMartha Washington kitchen at Mt. Vernon Martha Washington's kitchen at Mount Vernon, Va.Martha Washington's kitchen at Mount Vernon, Va. The Old kitchen, Longfellow's Wayside Inn, South Sudbury, Mass.The Old kitchen, Longfellow's Wayside Inn, South Sudbury, Mass. A Mexican interior, the fireplaceA Mexican interior, the fireplace Interior, colonial-style kitchen with firearmsInterior, colonial-style kitchen with firearms